Protein Info for EX31_RS13930 in Rahnella sp. WP5

Annotation: AI-2E family transporter YdiK

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 365 transmembrane" amino acids 12 to 30 (19 residues), see Phobius details amino acids 36 to 53 (18 residues), see Phobius details amino acids 64 to 86 (23 residues), see Phobius details amino acids 161 to 180 (20 residues), see Phobius details amino acids 201 to 212 (12 residues), see Phobius details amino acids 214 to 239 (26 residues), see Phobius details amino acids 244 to 272 (29 residues), see Phobius details amino acids 278 to 297 (20 residues), see Phobius details amino acids 308 to 337 (30 residues), see Phobius details PF01594: AI-2E_transport" amino acids 16 to 343 (328 residues), 175.1 bits, see alignment E=1.1e-55

Best Hits

Swiss-Prot: 68% identical to YDIK_ECOLI: Putative transport protein YdiK (ydiK) from Escherichia coli (strain K12)

KEGG orthology group: None (inferred from 100% identity to rah:Rahaq_2804)

Predicted SEED Role

"Putative membrane protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (365 amino acids)

>EX31_RS13930 AI-2E family transporter YdiK (Rahnella sp. WP5)
MNLPIKRYDLPQIIFGVLFIALMTVASIWIVQPFILGFVWAGMVVIATWPLMIKLQRLLW
GRRFLAVIIMTLLLILLFVLPIALLVSSAVENGAPLVEIASHPSSLHMPDFQWLNAIPLV
GNKLYNGWHALINGGGNALMSKVQPYVGQTAAWFVTQAGHLGRFIVHCALMLLFSALLYS
RGENVAMGIRHFAVRLAAERGDAAVILAGQAIRAVALGVVVTAIVQSVLGGIGLAIAGIP
YATVLTVVMFVCCVAQIGPLLVLIPAIIWLYWSGDNTWGTVLLVWSCVVGSLDNVLRPVL
IRMGADLPMLLILSGVIGGLFAFGMIGLFIGPVVLAVSYRLISLWVNEAPEPDMEPEEAL
KALDE