Protein Info for EX31_RS13910 in Rahnella sp. WP5

Annotation: Fe-S cluster assembly scaffold SufA

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• TIGR01997: FeS assembly scaffold SufA
  • amino acids 18 to 123 (106 residues), 142.9 bits, E=3.9e-46
• PF01521: Fe-S_biosyn
  • amino acids 19 to 118 (100 residues), 63.6 bits, E=9.9e-22
• TIGR00049: iron-sulfur cluster assembly accessory protein
  • amino acids 19 to 122 (104 residues), 111 bits, E=3.2e-36

Best Hits

Swiss-Prot: 70% identical to SUFA_ECOLI: Protein SufA (sufA) from Escherichia coli (strain K12)

KEGG orthology group: K05997, Fe-S cluster assembly protein SufA (inferred from 100% identity to rah:Rahaq_2799)

MetaCyc: 49% identical to iron-sulfur cluster insertion protein IscA (Escherichia coli K-12 substr. MG1655)

Predicted SEED Role

"Iron binding protein SufA for iron-sulfur cluster assembly"

Protein Sequence (123 amino acids)

>EX31_RS13910 Fe-S cluster assembly scaffold SufA (Rahnella sp. WP5)
MQTETVGSFSLDDNVWQGVSLTDSAAKQINTLVAQDPEVKGLQLSVKQSGCAGFGYVLDL
TKQPASDDLVFEHDGALLFVPLKAMPFIDGTEVDFVREGLNQIFKFNNPKAQHACGCGES
FGV