Protein Info for EX31_RS13905 in Rahnella sp. WP5

Annotation: Fe-S cluster assembly protein SufB

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 507 TIGR01980: FeS assembly protein SufB" amino acids 21 to 498 (478 residues), 643.6 bits, see alignment E=7.3e-198 PF19295: SufBD_N" amino acids 168 to 228 (61 residues), 49.5 bits, see alignment E=4.1e-17 PF01458: SUFBD" amino acids 245 to 478 (234 residues), 237.4 bits, see alignment E=1.6e-74

Best Hits

KEGG orthology group: K09014, Fe-S cluster assembly protein SufB (inferred from 97% identity to rah:Rahaq_2798)

Predicted SEED Role

"Iron-sulfur cluster assembly protein SufB" in subsystem Staphylococcal phi-Mu50B-like prophages

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (507 amino acids)

>EX31_RS13905 Fe-S cluster assembly protein SufB (Rahnella sp. WP5)
MSRSNVEIPDDVQSWVGEGTNYKEGFFTQLATDELASGINEDVVRAISAKRNEPEWMLEF
RLQAYHAWLKMEEPHWLKAYYTPLDYQDYSYYSAPSCGSCDDTCGSQPGAKQQPPEDSHS
IPALDGKNYLTSEVEKAFEQLGVPVREGKEVAVDAIFDSVSVSTTYRDKLAESGVIFCSF
GEAIHEYPDLVRKYLGTVVPAQDNFFAALNAAVASDGTFVYVPKGVRCPMELSTYFRINA
AKTGQFERTILIADEGSYVSYIEGCSAPVRDTYQLHAAVVEVILHKDAEVKYSTVQNWFS
GSKDSSGGILNFVTKRALCEGAGSKMSWTQSETGSAITWKYPSVILKGDNSIGEFFSVAL
TSGKQQADTGTKMIHIGKNTKSTIISKGISAGHSQNSYRGLVKILPSAENARNFTQCDSM
LIGADSAAHTFPYVEVRNNTAQLEHEATTSKIGDDQLFYCLQRGISEDDAISMIVNGFCK
DVFSELPLEFAVEAQKLLAISLEHSVG