Protein Info for EX31_RS13635 in Rahnella sp. WP5

Annotation: AzlC family ABC transporter permease

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 253 transmembrane" amino acids 26 to 47 (22 residues), see Phobius details amino acids 55 to 82 (28 residues), see Phobius details amino acids 114 to 133 (20 residues), see Phobius details amino acids 145 to 166 (22 residues), see Phobius details amino acids 178 to 196 (19 residues), see Phobius details amino acids 203 to 228 (26 residues), see Phobius details PF03591: AzlC" amino acids 27 to 167 (141 residues), 135.6 bits, see alignment E=8.2e-44

Best Hits

Swiss-Prot: 66% identical to YGAZ_ECOLI: Inner membrane protein YgaZ (ygaZ) from Escherichia coli (strain K12)

KEGG orthology group: None (inferred from 100% identity to rah:Rahaq_0749)

MetaCyc: 66% identical to L-valine exporter, YgaZ component (Escherichia coli K-12 substr. MG1655)
TRANS-RXN0-269

Predicted SEED Role

"FIG00638108: hypothetical protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (253 amino acids)

>EX31_RS13635 AzlC family ABC transporter permease (Rahnella sp. WP5)
MQTNPDLEAPDPVRVSTFAQGITDSLPIVIGYLPIAFAFGLSAVKLGFTPAESLLFSILI
YAGASQFVITALLSAGMSLWVSALTVMAMDVRHVLYGPSLRNRLAGKLNGKKTALWAFGL
TDEVFAAATARLIRDKRSWSENWMCGIALSSWLSWVSGTAVGALFGNGPLENFPAVEAAL
GFMLPALFLSFLLAAFKRQQSIVFVASLAGALGGLLFWSIPAAIGGGLGAGCLAALLQRP
QSSSATEITSDEH