Protein Info for EX31_RS13625 in Rahnella sp. WP5

Annotation: glycine betaine/L-proline ABC transporter substrate-binding protein ProX

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF04069: OpuAC
  • amino acids 32 to 307 (276 residues), 178.4 bits, E=1.1e-56

Best Hits

Swiss-Prot: 78% identical to PROX_ECO57: Glycine betaine/proline betaine-binding periplasmic protein (proX) from Escherichia coli O157:H7

KEGG orthology group: K02002, glycine betaine/proline transport system substrate-binding protein (inferred from 100% identity to rah:Rahaq_0753)

MetaCyc: 78% identical to glycine betaine ABC transporter periplasmic binding protein ProX (Escherichia coli K-12 substr. MG1655)
RXN-8638 [EC: 7.6.2.9]; 7.4.2.- [EC: 7.6.2.9]

Predicted SEED Role

"L-proline glycine betaine binding ABC transporter protein ProX (TC 3.A.1.12.1)" in subsystem Choline and Betaine Uptake and Betaine Biosynthesis (TC 3.A.1.12.1)

Isozymes

No predicted isozymes

Use Curated BLAST to search for 7.6.2.9

Protein Sequence (331 amino acids)

>EX31_RS13625 glycine betaine/L-proline ABC transporter substrate-binding protein ProX (Rahnella sp. WP5)
MKKTGIWAVAALTTFATATTFAADLPGKGISVTPVQSTISEESFQTELVSKALEKLGYDV
QPTREVDYNVGYTTLAAGDATFTAVNWSPLHDEMYKAAGGDKVFYREGTYVTGAAQGWLI
DKKTAEKYHITNIEQLKDPKLAKLFDTNGDGKADLTGCTPGWGCEAALNEQLKAYGLEPT
VTHNQGNYSAMIADTITRYKEGKPIFYYTWTPYWVSNVLIPGKDVLWMQVPFSVVPGDKN
ADTKLPNGKNYGFPVSTMHIVANKAWAEKNPAAAKLFAIMKLPLKDINAQNAAMHAGKNS
DADIAAQTDGWIKAHQEEFDGWVKEAAAAAK