Protein Info for EX31_RS13615 in Rahnella sp. WP5

Annotation: glycine betaine/L-proline ABC transporter permease ProW

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 399 transmembrane" amino acids 151 to 184 (34 residues), see Phobius details amino acids 190 to 214 (25 residues), see Phobius details amino acids 235 to 262 (28 residues), see Phobius details amino acids 310 to 334 (25 residues), see Phobius details amino acids 345 to 364 (20 residues), see Phobius details PF00528: BPD_transp_1" amino acids 206 to 364 (159 residues), 97.4 bits, see alignment E=4.6e-32

Best Hits

Swiss-Prot: 70% identical to OUSW_DICD3: Glycine betaine/choline transport system permease protein OusW (ousW) from Dickeya dadantii (strain 3937)

KEGG orthology group: K02001, glycine betaine/proline transport system permease protein (inferred from 100% identity to rah:Rahaq_0755)

Predicted SEED Role

"L-proline glycine betaine ABC transport system permease protein ProW (TC 3.A.1.12.1)" in subsystem Choline and Betaine Uptake and Betaine Biosynthesis (TC 3.A.1.12.1)

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (399 amino acids)

>EX31_RS13615 glycine betaine/L-proline ABC transporter permease ProW (Rahnella sp. WP5)
MSTSTITNTITQHAQAAQAQALDPSVDPWSADNASGGVAPQADAAAHAAPADAGSSDPWG
GSSDAATSTPDATHHAAAQTNDWLSVAPEQHQHFNILDPFHSTLIPLDRWVTEGIDWLVG
NFRPVFQGIRVPVDFVLSGFQHGLESLPAPIAILVFALLAWQMAGFGMGAATLVSLVLIG
AIGAWSQAMVTLALVLTSLFFCILIGLPLGIWLARSQRAAKIIRPLLDAMQTTPAFVYLV
PIVMLFGIGNVPGVVVTIIFALPPVVRLTILGINQVPEDLIEAAKSFGSSPRQLLFKVQL
PLAMPTIMAGINQTLMLALSMVVIASMIAVGGLGQMVLRGIGRLDMGLASVGGAGIVILA
IILDRLTQSMGRDSRSKGGHRWFTRGPVGLVMKPFTKKA