Protein Info for EX31_RS13600 in Rahnella sp. WP5

Annotation: sensor histidine kinase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 transmembrane" amino acids 12 to 34 (23 residues), see Phobius details amino acids 173 to 192 (20 residues), see Phobius details PF17203: sCache_3_2" amino acids 35 to 163 (129 residues), 53.1 bits, see alignment E=9.6e-18 PF00989: PAS" amino acids 215 to 316 (102 residues), 30.1 bits, see alignment E=1e-10 PF14501: HATPase_c_5" amino acids 423 to 525 (103 residues), 33.3 bits, see alignment E=9.6e-12 PF02518: HATPase_c" amino acids 425 to 539 (115 residues), 64 bits, see alignment E=4.4e-21

Best Hits

KEGG orthology group: K07700, two-component system, CitB family, cit operon sensor histidine kinase CitA [EC: 2.7.13.3] (inferred from 100% identity to rah:Rahaq_0758)

Predicted SEED Role

"Sensor kinase CitA, DpiB (EC 2.7.3.-)" in subsystem Orphan regulatory proteins (EC 2.7.3.-)

Isozymes

Compare fitness of predicted isozymes for: 2.7.13.3, 2.7.3.-

Use Curated BLAST to search for 2.7.13.3 or 2.7.3.-

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (550 amino acids)

>EX31_RS13600 sensor histidine kinase (Rahnella sp. WP5)
MKFRLPFQVKLFLSLVVFSCVLLALLGAILFHIIDRQLHHDLGQRARVQASEIALMPGLA
QKVQARDIPGIAKLIQPLRDKSDASYIVIGDTRELHLYHSESPERIDLPMIGGDNAGVLA
GKTIISVRQGGIGVSLRSKAPILDASNQVIGIVSVGYLTSYIDNINGRRLAQAGLYGLLL
LLLLFIFSWMFTRNVKKQMFWLEPKDIALLVRQQKALLEAMYEGVFAINAERQLISINRA
ARELLDIRQPENELLGKPLAEVLQTPPTFFMQRGVSENNSQHDQITVLNQRQVIVNRVPI
ELEPGAESGWVFSFRDKNDINTLSSQLSQVKRYADNLRIMRHEQLNWTATLAGLLQMQRY
DDAMRYIQAQSEGAQAVLDFVSARFTSPALCGLLLGKYVSAREKGVELSFDPACQLTRIP
AAISETELMSVIGNLLDNAVDATLKALTPPAPVELYISDRNRELLIEVADQGSGVEDALK
PHLFEQGVTSKPSSGQDATGAEHGIGLYLVAGYVRQAGGSIEISDNTPQGTIFSVFIPYP
AEALTGQNHE