Protein Info for EX31_RS13595 in Rahnella sp. WP5

Annotation: 2-hydroxycarboxylate transporter family protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 451 transmembrane" amino acids 32 to 51 (20 residues), see Phobius details amino acids 62 to 79 (18 residues), see Phobius details amino acids 89 to 107 (19 residues), see Phobius details amino acids 126 to 142 (17 residues), see Phobius details amino acids 154 to 178 (25 residues), see Phobius details amino acids 184 to 210 (27 residues), see Phobius details amino acids 222 to 240 (19 residues), see Phobius details amino acids 276 to 293 (18 residues), see Phobius details amino acids 301 to 320 (20 residues), see Phobius details amino acids 336 to 356 (21 residues), see Phobius details amino acids 367 to 385 (19 residues), see Phobius details amino acids 428 to 449 (22 residues), see Phobius details PF03390: 2HCT" amino acids 34 to 442 (409 residues), 468.8 bits, see alignment E=6.7e-145

Best Hits

Swiss-Prot: 37% identical to MAEN_BACSU: Na(+)-malate symporter (maeN) from Bacillus subtilis (strain 168)

KEGG orthology group: None (inferred from 100% identity to rah:Rahaq_0759)

Predicted SEED Role

"Malate Na(+) symporter" in subsystem Pyruvate metabolism I: anaplerotic reactions, PEP

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (451 amino acids)

>EX31_RS13595 2-hydroxycarboxylate transporter family protein (Rahnella sp. WP5)
MSTTDDSYIAVKETKTSGLSARQKWWHILDHYKIGIIPLPFFLLAGVLILLDCLNGKLPS
DIVVMVATLAFFGFACGELGKRLPVVGKLGAAAICATFIPSAMVHYGLLPDVVVDSTVKF
YKSTNILYLYICCIIVGSIMSMNRQVLIQGFMRIFVPMLCGEVVGMIAGMAMGTVLGLPP
MQTFFFLILPIMAGGVGEGAIPLSMGYATILHMEQGVALGRILPIVMLGGLTAIVLAGVL
NQLGKRYPHLTGEGQLMPSKKGQMGSGTDEFEGNPGVNALACGALLAILLYMVGMLGQKW
IGLPAPVGMLFAAVLVKLANGVSPTIQHGSMTVYKFFRTAVTYPVLFAVGVAITPWQELI
NAFTLQNLLVIVTTVLALVGTGFYVGKKIGMHPIDVAIVSCCQSGQGGTGDVAILTSGNR
MTLMPFAQIATRIGGAINVSVGLFVLAKFFS