Protein Info for EX31_RS13395 in Rahnella sp. WP5

Annotation: M15 family metallopeptidase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 181 PF02557: VanY" amino acids 55 to 178 (124 residues), 109.9 bits, see alignment E=4e-36

Best Hits

KEGG orthology group: None (inferred from 99% identity to rah:Rahaq_0795)

Predicted SEED Role

"D-alanyl-D-alanine carboxypeptidase (EC 3.4.16.4)" in subsystem Peptidoglycan Biosynthesis (EC 3.4.16.4)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 3.4.16.4

Use Curated BLAST to search for 3.4.16.4

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (181 amino acids)

>EX31_RS13395 M15 family metallopeptidase (Rahnella sp. WP5)
MNPAALKSQTEQILRELHIDPAVIAHRTLPYFEEVSEHLLVEAETDAESGKIYRLTAPAS
AAWHTMRQQAATDGVGIYLVSAYRSLNYQADLIRAKQLAGIAPEDFFTSLAPPGCSEHHT
GCAVDINTPGCDEVTGVFGETEAFQWLQSHAAGFGFVMSFPLNNPWGFIYEPWHWCWHSN
S