Protein Info for EX31_RS13255 in Rahnella sp. WP5

Annotation: PTS sugar transporter subunit IIB

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF02302: PTS_IIB
  • amino acids 3 to 99 (97 residues), 66.8 bits, E=1.1e-22

Best Hits

Swiss-Prot: 45% identical to PTEB_BACSU: PTS system oligo-beta-mannoside-specific EIIB component (gmuB) from Bacillus subtilis (strain 168)

KEGG orthology group: K02760, PTS system, cellobiose-specific IIB component [EC: 2.7.1.69] (inferred from 100% identity to rah:Rahaq_0822)

Predicted SEED Role

"PTS system, cellobiose-specific IIB component (EC 2.7.1.69)" in subsystem Beta-Glucoside Metabolism (EC 2.7.1.69)

KEGG Metabolic Maps

• Aminosugars metabolism
• Ascorbate and aldarate metabolism
• Fructose and mannose metabolism
• Galactose metabolism
• Glycolysis / Gluconeogenesis
• Nucleotide sugars metabolism
• Starch and sucrose metabolism

Isozymes

Compare fitness of predicted isozymes for: 2.7.1.69

Use Curated BLAST to search for 2.7.1.69

Protein Sequence (105 amino acids)

>EX31_RS13255 PTS sugar transporter subunit IIB (Rahnella sp. WP5)
MKRIVLACSAGMSTSLVVTKMEKEVTARGLEYQIYAIPENNLRDELEAYGRDIVAVLLGP
QVRFKLAENKKLTDEHGIPIAVIDMVAYGTLNGAKVLDQALSLIQ