Protein Info for EX31_RS13055 in Rahnella sp. WP5

Annotation: DUF3461 family protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 129 PF11944: DUF3461" amino acids 1 to 125 (125 residues), 186.7 bits, see alignment E=7.9e-60

Best Hits

Swiss-Prot: 90% identical to Y3794_SERP5: UPF0325 protein Spro_3794 (Spro_3794) from Serratia proteamaculans (strain 568)

KEGG orthology group: None (inferred from 100% identity to rah:Rahaq_0859)

Predicted SEED Role

"UPF0325 protein YaeH"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (129 amino acids)

>EX31_RS13055 DUF3461 family protein (Rahnella sp. WP5)
MYDNLKSLGINNPDDIDRYSLRQEANNDILKIYFRRDKGEFFAKSVKFKYPRQRKTIVAD
NAGQGYKEIHEISPNLRYVIDELDQICQRDQVEVDLKRKILDDLRHLESVVANKISEIES
DLEKLTNGR