Protein Info for EX31_RS13000 in Rahnella sp. WP5

Annotation: sigma E protease regulator RseP

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 451 signal peptide" amino acids 1 to 21 (21 residues), see Phobius details transmembrane" amino acids 98 to 121 (24 residues), see Phobius details amino acids 377 to 399 (23 residues), see Phobius details amino acids 427 to 446 (20 residues), see Phobius details TIGR00054: RIP metalloprotease RseP" amino acids 2 to 451 (450 residues), 534 bits, see alignment E=1.3e-164 PF02163: Peptidase_M50" amino acids 10 to 439 (430 residues), 262.8 bits, see alignment E=4.2e-82 PF00595: PDZ" amino acids 223 to 277 (55 residues), 37.8 bits, see alignment 4.2e-13 PF13180: PDZ_2" amino acids 225 to 287 (63 residues), 32 bits, see alignment E=2.5e-11 PF17820: PDZ_6" amino acids 228 to 259 (32 residues), 34.2 bits, see alignment (E = 3.5e-12)

Best Hits

Swiss-Prot: 84% identical to RSEP_YERPE: Protease RseP (rseP) from Yersinia pestis

KEGG orthology group: K11749, regulator of sigma E protease [EC: 3.4.24.-] (inferred from 100% identity to rah:Rahaq_0870)

MetaCyc: 76% identical to intramembrane zinc metalloprotease RseP (Escherichia coli K-12 substr. MG1655)
3.4.21.-; RXN-18678

Predicted SEED Role

"Membrane-associated zinc metalloprotease" in subsystem Sex pheromones in Enterococcus faecalis and other Firmicutes

MetaCyc Pathways

Isozymes

Compare fitness of predicted isozymes for: 3.4.24.-

Use Curated BLAST to search for 3.4.24.-

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (451 amino acids)

>EX31_RS13000 sigma E protease regulator RseP (Rahnella sp. WP5)
MMNILWSLAAFIVALGVLITVHEFGHFWVARRCGVRVERFSVGFGRALWRRTDRQGTEYV
LAIIPLGGYVKMLDERVEAVAPEFRHQSFNNKKIWQRAAIISAGPIANFIFAVFAYWLIF
VIGVPSVRPVVANVTANSIAAQSNISPGMELKSVAGIETPDWDSVRMALVGEIGDDQTTV
DVAQFGSSQVVEKTLDLRQWQFDPEKQDPVVSLGMIPRGPQIESVLQEVQPDSAAQKAGL
QAGDRIVKVDGQILESWQSFVIQVRDNPGKPIALEVERAGNPVALTLTPDTKSAGKGKIQ
GFAGVVPKVIPLPDEYKTIRQYGPFVAFYEAGDKTWQLMKLTVSMLGKLITGDVKLNNLS
GPISIAQGAGMSAEYGLVSYLTFLALISVNLGIINLFPLPVLDGGHLLFLAIEKLKGGPV
SERVQDFSYRIGSVLLVLLMGLALFNDFSRL