Protein Info for EX31_RS12855 in Rahnella sp. WP5

Annotation: DUF898 domain-containing protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 396 transmembrane" amino acids 24 to 44 (21 residues), see Phobius details amino acids 74 to 93 (20 residues), see Phobius details amino acids 98 to 117 (20 residues), see Phobius details amino acids 140 to 166 (27 residues), see Phobius details amino acids 172 to 194 (23 residues), see Phobius details amino acids 229 to 255 (27 residues), see Phobius details amino acids 275 to 299 (25 residues), see Phobius details amino acids 325 to 346 (22 residues), see Phobius details PF05987: DUF898" amino acids 12 to 388 (377 residues), 326.9 bits, see alignment E=7.3e-102

Best Hits

KEGG orthology group: None (inferred from 100% identity to rah:Rahaq_3878)

Predicted SEED Role

"Thymidylate kinase (EC 2.7.4.9)" (EC 2.7.4.9)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 2.7.4.9

Use Curated BLAST to search for 2.7.4.9

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (396 amino acids)

>EX31_RS12855 DUF898 domain-containing protein (Rahnella sp. WP5)
MSDNNQYNDNLHQVRFHGKGGEYFAIWLVNALLTIITLGVYSAWATVRRRRYFLGNTEIN
GDRFDYHAKPVQILKGRLLVIGGIIVFYILAALLPQLALLIALVFLALLPWVIIRSWRYN
AIMTSYRGVRFNYHCKTGRAYWTMYLCPILLMLAVYIPITAVVLIAVQMASISAILISVV
LVAVALVPGVAAVQGIISAMTHDLYVNNLFFGNTAFRADLKKAAFIKYSLLGIVLFLPFL
IIALWLMGSFFTTLLQMAYMGGMSEDMAGMMLMSNLFSFILAFIIMFVGALVVASYQVVA
VRNYVFNQTQIGDRVKLRSSMKTMSYLGLLFTNALIVVCSLGLATPVAHVRSARYMAACT
AVTGDLSLLEVQAHADTANTAVAEEVTQAFDLGVGM