Protein Info for EX31_RS12840 in Rahnella sp. WP5

Annotation: PTS transporter subunit EIIC

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 510 transmembrane" amino acids 112 to 134 (23 residues), see Phobius details amino acids 144 to 164 (21 residues), see Phobius details amino acids 171 to 188 (18 residues), see Phobius details amino acids 245 to 265 (21 residues), see Phobius details amino acids 280 to 306 (27 residues), see Phobius details amino acids 312 to 342 (31 residues), see Phobius details amino acids 361 to 380 (20 residues), see Phobius details amino acids 392 to 411 (20 residues), see Phobius details amino acids 424 to 453 (30 residues), see Phobius details amino acids 462 to 484 (23 residues), see Phobius details PF00367: PTS_EIIB" amino acids 10 to 43 (34 residues), 54 bits, see alignment (E = 9e-19) PF02378: PTS_EIIC" amino acids 107 to 425 (319 residues), 116.5 bits, see alignment E=1.4e-37

Best Hits

KEGG orthology group: K02755, PTS system, beta-glucosides-specific IIA component [EC: 2.7.1.69] K02756, PTS system, beta-glucosides-specific IIB component [EC: 2.7.1.69] K02757, PTS system, beta-glucosides-specific IIC component (inferred from 99% identity to rah:Rahaq_3881)

Predicted SEED Role

"PTS system, beta-glucoside-specific IIB component (EC 2.7.1.69) / PTS system, beta-glucoside-specific IIC component / PTS system, beta-glucoside-specific IIA component" in subsystem Beta-Glucoside Metabolism (EC 2.7.1.69)

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 2.7.1.69

Use Curated BLAST to search for 2.7.1.69

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (510 amino acids)

>EX31_RS12840 PTS transporter subunit EIIC (Rahnella sp. WP5)
MAINYAQTAQDIVKYIGGDNNVISITHCATRLRFVLKDNKAVDKEELKRVKGVITVIEAG
GQMQVVIGNHVSDAYNQVLKLIQIDENAPVSAPNVGIVSRVMDVISSIFTPFLYQLAACG
ILQGIISFLAAIGIMDASSGTYRILNFVSWTAFTFLPVMIAFTAAKKFNVNPFTAVITAC
ALISPDYMNMLTAFKITSINSADPAMQQLMREAVSNPDIANILQNVVGIPVSAPTLDFLG
IPVKYLSYTASVIPIILMVWAMSYIEHFFNKVLPVVIRNLFTPMFCIAIMVPMTLLVFGP
VGNLIGGAIGGVYNYLYHLSPTIAGFVVGAFWQPLVTLGVHWGITPVTVGNYATLGYDTF
TGLQASAVFAMTGSMFGVYLKTRSREMKGISLSAGVTGLFGITEPAIYGVALRLKKPFLC
SCVAGGIGGAIAGSFNAVSWSYCLPGIAVLPVFFKEGHMPQFLGFLLSISVAFVLGALFT
WLVGFKDEPDVAAPQKVPAETRRAAQAEMN