Protein Info for EX31_RS12810 in Rahnella sp. WP5

Annotation: arginine deiminase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 406 TIGR01078: arginine deiminase" amino acids 5 to 406 (402 residues), 529 bits, see alignment E=3.5e-163 PF02274: ADI" amino acids 35 to 403 (369 residues), 443.5 bits, see alignment E=6.9e-137 PF19420: DDAH_eukar" amino acids 148 to 276 (129 residues), 30.5 bits, see alignment E=2.2e-11

Best Hits

Swiss-Prot: 80% identical to ARCA_SALPC: Arginine deiminase (arcA) from Salmonella paratyphi C (strain RKS4594)

KEGG orthology group: K01478, arginine deiminase [EC: 3.5.3.6] (inferred from 100% identity to rah:Rahaq_3887)

Predicted SEED Role

"Arginine deiminase (EC 3.5.3.6)" in subsystem Arginine Deiminase Pathway or Arginine and Ornithine Degradation (EC 3.5.3.6)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 3.5.3.6

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (406 amino acids)

>EX31_RS12810 arginine deiminase (Rahnella sp. WP5)
MKRHYVGSEIGQLRSVMLHRPNLSLQRLTPSNCQELLFDDVLSVERAGKEHDVFSQTLRQ
QGVEVLLLTDLLTETLDNREAKDWLLSRQISDYRLGPQFAEEIRGWLADLPHRQTARFMS
GGLTYSEIPDTFHNMVTDTHQLNDFVIKPLPNHLFTRDTSCWIYNGVSVNPMAKEARKRE
TNNLRAIYRWHPHFTDNEFITYFGDDEFNYDHATLEGGDVLVIGRGAVLIGLSERTTPQG
VEFLARSLFKHQQATKVIVLQLPKHRSCMHLDTVMTHIDLDTFSVYPEVVRDTTLCWTLT
DNGHGGLRRTEEPQFVRAIGKALGIDDIRLITTGGDSFEAEREQWNDANNVLTVRPGVVI
GYERNTRTNEKYDKAGITVLPIPGDELGRGRGGARCMSCPLERDDI