Protein Info for EX31_RS12795 in Rahnella sp. WP5

Annotation: YfcC family protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 467 transmembrane" amino acids 9 to 28 (20 residues), see Phobius details amino acids 79 to 100 (22 residues), see Phobius details amino acids 121 to 140 (20 residues), see Phobius details amino acids 146 to 195 (50 residues), see Phobius details amino acids 201 to 222 (22 residues), see Phobius details amino acids 260 to 279 (20 residues), see Phobius details amino acids 284 to 304 (21 residues), see Phobius details amino acids 322 to 342 (21 residues), see Phobius details amino acids 355 to 379 (25 residues), see Phobius details amino acids 384 to 402 (19 residues), see Phobius details amino acids 414 to 435 (22 residues), see Phobius details amino acids 443 to 465 (23 residues), see Phobius details PF03606: DcuC" amino acids 6 to 462 (457 residues), 405.9 bits, see alignment E=9.7e-126

Best Hits

KEGG orthology group: None (inferred from 99% identity to rah:Rahaq_3890)

Predicted SEED Role

"Arginine/ornithine antiporter ArcD" in subsystem Arginine Deiminase Pathway or Arginine and Ornithine Degradation or Polyamine Metabolism

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (467 amino acids)

>EX31_RS12795 YfcC family protein (Rahnella sp. WP5)
MRTFKFPSAYTILFVLIALVAGLSWIIPAGQYDMAMNARLGKEVPVSGTYHAVTGNPQGL
VDIFLAPIDGLYNHTTGQAGAIDVALFILIIGGFLGIVTKTGAIDAGIERVTVRLKGKEE
WMIPILMALFAAGGTIYGMAEESLPFYTLLVPVMMAARFDPLVAAATVLLGAGIGTLGST
INPFATVIAANAAGIPFTHGIGLRVAILIIGWLICVIWVMRYARKVRRDPSLSVVADQWD
SNRAHFLGNRSDELLPFTGVRKIILLIFALAFVVMIYGVSVKGWWMGEISGVFLAAAILV
GLIARMSEEELTSTFIDGARDLLGVALIIGIARGIVVIMDNGMITHTILHSAEGIVSGLS
SVIFINVMFLLEVVLSFLVPSSSGLAVMTMPIMAPLADFAHVGRELVVTAYQSASGLVNL
VTPTSAVVMGGLAIARVPYVRWLKWVAPLMGILLILLMFALSLGSLV