Protein Info for EX31_RS12725 in Rahnella sp. WP5
Annotation: Gfo/Idh/MocA family oxidoreductase
These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.
Protein Families and Features
Best Hits
Swiss-Prot: 64% identical to YCJS_ECOLI: Uncharacterized oxidoreductase YcjS (ycjS) from Escherichia coli (strain K12)
KEGG orthology group: None (inferred from 99% identity to rah:Rahaq_3914)MetaCyc: 64% identical to D-glucoside 3-dehydrogenase (Escherichia coli K-12 substr. MG1655)
1.1.1.-
Predicted SEED Role
"Putative oxidoreductase YcjS (EC 1.-.-.-), NADH-binding" in subsystem Maltose and Maltodextrin Utilization (EC 1.-.-.-)
MetaCyc Pathways
- D-gulosides conversion to D-glucosides (3/3 steps found)
KEGG Metabolic Maps
- Alkaloid biosynthesis I
- Carotenoid biosynthesis - General
- Insect hormone biosynthesis
- Nucleotide sugars metabolism
- Porphyrin and chlorophyll metabolism
- Puromycin biosynthesis
- Trinitrotoluene degradation
- alpha-Linolenic acid metabolism
Isozymes
Compare fitness of predicted isozymes for: 1.-.-.-
Use Curated BLAST to search for 1.-.-.-
Sequence Analysis Tools
PaperBLAST (search for papers about homologs of this protein)
Search CDD (the Conserved Domains Database, which includes COG and superfam)
Compare to protein structures
Predict protein localization: PSORTb (Gram-negative bacteria)
Predict transmembrane helices and signal peptides: Phobius
Check the current SEED with FIGfam search
Find homologs in fast.genomics or the ENIGMA genome browser
Find the best match in UniProt
Protein Sequence (352 amino acids)
>EX31_RS12725 Gfo/Idh/MocA family oxidoreductase (Rahnella sp. WP5) MEFITKPAGTLKVALVGAGQVAEKVHVACYRQLPGLELVAVVDCDTARAQAFAGRNGIAR AFTSLEEMLEAERPDIVSICTPNLFHHQQVITALQHGCHVFCEKPPAMTAAQALDMWQAA EQAGRILAYDFHHRFAEDARILRQKVAAGELGEVYVTTARALRRCGVPGWGNFTDKTQSG GGPLIDIGIHMLDAAMYVLGFPVVRKVTAQMFQKIGNRKSEGQFGSWDPQKYSVEDSVFA AIEFCNGGLLRLETAFALNIQPQSVMNVEFCGDKAGATLFPAQVYTDEKGELVRLFHREV ADDQRHVRSVQAFVAAVRGETVSLADAEQGYRIQQLVAAVYQSAESGESVYL