Protein Info for EX31_RS12570 in Rahnella sp. WP5

Annotation: type II secretion protein F

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 348 transmembrane" amino acids 111 to 133 (23 residues), see Phobius details amino acids 163 to 186 (24 residues), see Phobius details amino acids 207 to 221 (15 residues), see Phobius details amino acids 315 to 335 (21 residues), see Phobius details PF00482: T2SSF" amino acids 16 to 136 (121 residues), 29.8 bits, see alignment E=2.6e-11 amino acids 215 to 333 (119 residues), 45 bits, see alignment E=5e-16

Best Hits

Swiss-Prot: 39% identical to TCPE_VIBCH: Toxin coregulated pilus biosynthesis protein E (tcpE) from Vibrio cholerae serotype O1 (strain ATCC 39315 / El Tor Inaba N16961)

KEGG orthology group: None (inferred from 100% identity to rah:Rahaq_3945)

Predicted SEED Role

"Toxin co-regulated pilus biosynthesis protein E, anchors TcpT to membrane" in subsystem Toxin co-regulated pilus or Vibrio pathogenicity island

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (348 amino acids)

>EX31_RS12570 type II secretion protein F (Rahnella sp. WP5)
MAKFGKKQRLFLYKFCADMIRTDLPLYDSLLKLQLEGKSLLGPGFAKNISVLTNNMKAGL
KGASIAVMFDGLVPQSELSVIHAAEQSGSLADGFMTLVNVINYNSELKSKLISAVLFPVI
MMILSLIVIAGYSMKVFPAFESVVPVNKWPGVTQSLYTFGKALVAGLWIYILIVITVTVF
FIKTIISNFSGQFRNKFLDRILPFSTYKQIVASIFINNLALMLKNGIPLNDGLAIILLNS
NRWLKHHINGMREKMAIGLGYGDALNTGLFGPETLLNISLYAELPSFNEVLSSVSAKSRE
HVQEYIKKLAGLLKSLSTLVLGGCVIWVFAALFALSDTLGKMGASGSF