Protein Info for EX31_RS12560 in Rahnella sp. WP5

Annotation: prepilin peptidase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 276 transmembrane" amino acids 6 to 28 (23 residues), see Phobius details amino acids 91 to 111 (21 residues), see Phobius details amino acids 117 to 135 (19 residues), see Phobius details amino acids 143 to 163 (21 residues), see Phobius details amino acids 169 to 189 (21 residues), see Phobius details amino acids 198 to 215 (18 residues), see Phobius details amino acids 221 to 240 (20 residues), see Phobius details amino acids 256 to 273 (18 residues), see Phobius details PF06750: A24_N_bact" amino acids 15 to 109 (95 residues), 106 bits, see alignment E=8.7e-35 PF01478: Peptidase_A24" amino acids 125 to 232 (108 residues), 64.7 bits, see alignment E=9.4e-22

Best Hits

KEGG orthology group: K02654, leader peptidase (prepilin peptidase) / N-methyltransferase [EC: 2.1.1.- 3.4.23.43] (inferred from 99% identity to rah:Rahaq_3947)

Predicted SEED Role

"Leader peptidase (Prepilin peptidase) (EC 3.4.23.43) / N-methyltransferase (EC 2.1.1.-)" in subsystem Type IV pilus (EC 2.1.1.-, EC 3.4.23.43)

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 2.1.1.-, 3.4.23.43

Use Curated BLAST to search for 2.1.1.- or 3.4.23.43

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (276 amino acids)

>EX31_RS12560 prepilin peptidase (Rahnella sp. WP5)
MTLFYFWFYPVMALIFGLFIGSFINVLIYRLPLMIFAEYGTEPDAVKVNLWWPPSHCPAC
GASVMKRDNIPVLSWLWLKGKCRHCESPISAQYLISEILCGCIFAALAIAGLPHFTEIQI
CCFFLYFCLLYSLTVIDFKHLILPDSLVSLLLWSGLLCSVLGITDIGPRSAICGAVIIWL
VLYAVMAAYEKWRGREGLGYGDVKLMAAITVWVGMEKIPELIMWSAASGIMVYVLCTVLN
QRRTLDENHPAAEKHYIPFGPSISMAGLVIFFIEQL