Protein Info for EX31_RS12545 in Rahnella sp. WP5

Annotation: penicillin-binding protein activator

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 600 650 678 signal peptide" amino acids 1 to 30 (30 residues), see Phobius details PF04348: LppC" amino acids 41 to 294 (254 residues), 159.7 bits, see alignment E=6.2e-51 amino acids 348 to 671 (324 residues), 283.7 bits, see alignment E=1.7e-88

Best Hits

Swiss-Prot: 64% identical to LPOA_SERP5: Penicillin-binding protein activator LpoA (lpoA) from Serratia proteamaculans (strain 568)

KEGG orthology group: K07121, (no description) (inferred from 100% identity to rah:Rahaq_3950)

Predicted SEED Role

"LppC putative lipoprotein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (678 amino acids)

>EX31_RS12545 penicillin-binding protein activator (Rahnella sp. WP5)
MPSSMTFRTRSGRLLPAIIVAMLLASCSGQAPQAPTESVQGAASGSSDYYLQQAQQSGDD
NKADWQLLAVRALIREGKAPQAAEQLAKVPQNLTAAQTVEQQLTSAEVQVALKNYPAAAT
SLSQLDPHDLTNDQKARYYQAQIDASQGRTSLGVIRAYIAQEPLVQGQPHQDNIDRTWMA
LTQMSAQDVNSIVINADENTLQGWLDLLSVWQSNKQDPDLLKAGIKDWQRRYPVNPAAKS
LPTQLNNVLTFQPASTGKIALFLPMSGPAQVYGNAIQQGFNAAMSGQVSQPAAQTAPTDP
NAQSQAPADPNAAVSTSAPDASTQNTASQTDPSQAQPAATPAAAPVASSNGQVKVYDTNG
QPLAALLTQAQQDGATLVVGPLLKDQVNALASDQTPLNVLALNQPETEKNSPNICYFALS
PEDEAQDAARHMWSEQKRMPLLLVPRGSFGDRIAQAFANEWQKLGGQTVLKQGLGSAGEL
RSSIGSGIRLTGTPVTTSDAAAPAQAQGVTIGGITIPAPPTDAQITQGSTGGAVDSVYVV
ATQSELTLIKPMLDLAVNGRVHPSVYASSRSYQAGAGPDYRLEMEGVQFSDIPLLAGGNP
ALMQQAAAKFGNDYSLVRLYAMGIDAWNLANHFSQMRTLPGFQVSGSTGELSANSNCVIH
RKLPWLQYRQGSLVPVSS