Protein Info for EX31_RS12540 in Rahnella sp. WP5

Annotation: YraN family protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 122 TIGR00252: TIGR00252 family protein" amino acids 6 to 121 (116 residues), 143 bits, see alignment E=2.3e-46 PF02021: UPF0102" amino acids 15 to 107 (93 residues), 94 bits, see alignment E=3.1e-31

Best Hits

Swiss-Prot: 75% identical to Y4337_SERP5: UPF0102 protein Spro_4337 (Spro_4337) from Serratia proteamaculans (strain 568)

KEGG orthology group: K07460, putative endonuclease (inferred from 100% identity to rah:Rahaq_3951)

Predicted SEED Role

"Predicted endonuclease distantly related to archaeal Holliday junction resolvase"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (122 amino acids)

>EX31_RS12540 YraN family protein (Rahnella sp. WP5)
MKSFLSKTRACGDKYEAFARRYLEKAGLTFVAANVACRAGEIDMIMRDQQTWVFVEVRYR
RNASFGGAAASVTIQKQQRLLRAASFWLAGKNASFDTSSCRFDVFAITGSQIEWLRDAFN
AE