Protein Info for EX31_RS12430 in Rahnella sp. WP5

Annotation: calcium/sodium antiporter

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 325 signal peptide" amino acids 1 to 19 (19 residues), see Phobius details transmembrane" amino acids 34 to 56 (23 residues), see Phobius details amino acids 68 to 93 (26 residues), see Phobius details amino acids 103 to 120 (18 residues), see Phobius details amino acids 129 to 150 (22 residues), see Phobius details amino acids 173 to 194 (22 residues), see Phobius details amino acids 201 to 231 (31 residues), see Phobius details amino acids 240 to 263 (24 residues), see Phobius details amino acids 276 to 292 (17 residues), see Phobius details amino acids 299 to 319 (21 residues), see Phobius details TIGR00367: K+-dependent Na+/Ca+ exchanger homolog" amino acids 2 to 312 (311 residues), 290.3 bits, see alignment E=8.2e-91 PF01699: Na_Ca_ex" amino acids 4 to 144 (141 residues), 113.7 bits, see alignment E=3.9e-37 amino acids 175 to 317 (143 residues), 110.2 bits, see alignment E=4.6e-36

Best Hits

Swiss-Prot: 60% identical to YRBG_ECOLI: Inner membrane protein YrbG (yrbG) from Escherichia coli (strain K12)

KEGG orthology group: K07301, inner membrane protein (inferred from 100% identity to rah:Rahaq_3974)

Predicted SEED Role

"Inner membrane protein YrbG, predicted calcium/sodium:proton antiporter"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (325 amino acids)

>EX31_RS12430 calcium/sodium antiporter (Rahnella sp. WP5)
MLLAIVLMIVGLLLLVYAADRLVYGAAVLARSMGISPLVIGMTVVGVGISLPELVVSTTA
AINDQMDLAVGNAIGSNIINILLILGGAALIHPLSVRSDILRRELPLLLLVTALCGFLLS
DGELSRFDGVLLLASAGVFMMLMIKIARAAEKEGLDTLTYEQMSELPQDSSNTVAFLWLA
LGFIIMPLASGMIVDNSTVIARYLGVSELVIGLTVIAIGTSLPELATFIAGAIKGEDDIA
LGNIIGANIFNTCLVLGLPALVAPGSFNPDAFHRDYWVMLAVSVVLSGLCLMRKHRIGHL
AGALLLCGFIAYMAVLFLLPDSIAF