Protein Info for EX31_RS12355 in Rahnella sp. WP5

Annotation: DUF4310 family protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 215 transmembrane" amino acids 14 to 37 (24 residues), see Phobius details amino acids 57 to 76 (20 residues), see Phobius details amino acids 87 to 109 (23 residues), see Phobius details amino acids 114 to 135 (22 residues), see Phobius details amino acids 162 to 190 (29 residues), see Phobius details amino acids 196 to 213 (18 residues), see Phobius details PF14187: DUF4310" amino acids 6 to 213 (208 residues), 348.8 bits, see alignment E=5.6e-109 TIGR03579: conserved hypothetical protein EF_0833/AHA_3914" amino acids 8 to 215 (208 residues), 388.8 bits, see alignment E=3.4e-121

Best Hits

KEGG orthology group: None (inferred from 100% identity to rah:Rahaq_3990)

Predicted SEED Role

"Putative inner membrane protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (215 amino acids)

>EX31_RS12355 DUF4310 family protein (Rahnella sp. WP5)
MEEQAKRGFWYAEWSFPIFVGLLSSGVFAGTHMYYLYGIGAFNEVAFVSMLRSGMDTGVY
GAVAAFGASFLFARIIEGSLVGILDIGGAIQTGIGLGVPAMLLGAGIIFPVANFAASLVT
GLILGLAVGYIIILARKFTINQSNSTYGADVMMGAGNASGRFLGPLIILSAMAASIPIGL
GSLIGALGFYLWQKPITGGAILGAMVLGAVFPVSL