Protein Info for EX31_RS12350 in Rahnella sp. WP5

Annotation: DUF4311 domain-containing protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 258 signal peptide" amino acids 1 to 23 (23 residues), see Phobius details transmembrane" amino acids 24 to 25 (2 residues), see Phobius details amino acids 55 to 75 (21 residues), see Phobius details amino acids 111 to 134 (24 residues), see Phobius details amino acids 143 to 165 (23 residues), see Phobius details amino acids 173 to 199 (27 residues), see Phobius details amino acids 211 to 232 (22 residues), see Phobius details TIGR03580: conserved hypothetical protein EF_0832/AHA_3913" amino acids 2 to 258 (257 residues), 497.6 bits, see alignment E=3.6e-154 PF14188: DUF4311" amino acids 25 to 236 (212 residues), 396.1 bits, see alignment E=2.2e-123

Best Hits

KEGG orthology group: None (inferred from 99% identity to rah:Rahaq_3991)

Predicted SEED Role

"Putative inner membrane protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (258 amino acids)

>EX31_RS12350 DUF4311 domain-containing protein (Rahnella sp. WP5)
MFLIILFKSLIIGGLVGVGVGAGAARMFHAPTVQGMGAFRTLGELNSCEGDPASHFSFGL
GFFFNAWASSVAAGSFTQDVDHRIIPHWATAALMFKNRNVAETMHDPRKMAIAGGIIGMI
VVAFLNTTASAVPAALQVTAIKVLVPAANLLVNTVMPVIFWLAAIDAGRRSGFWATIFGG
LAQMIMGNAVPGLVLGILIGKGVEESGWNHVTKVMMAAIIALFVLSGFFRGFDVKLLQSF
MLDVPTWLNGIHNSLSGK