Protein Info for EX31_RS12230 in Rahnella sp. WP5

Annotation: RNase E specificity factor CsrD

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 600 644 transmembrane" amino acids 7 to 32 (26 residues), see Phobius details amino acids 139 to 160 (22 residues), see Phobius details PF17157: GAPES4" amino acids 35 to 132 (98 residues), 67.4 bits, see alignment E=1.9e-22 PF00990: GGDEF" amino acids 225 to 378 (154 residues), 74.2 bits, see alignment E=1.6e-24 PF00563: EAL" amino acids 401 to 628 (228 residues), 142.6 bits, see alignment E=2.1e-45

Best Hits

Swiss-Prot: 56% identical to CSRD_ECOLI: RNase E specificity factor CsrD (csrD) from Escherichia coli (strain K12)

KEGG orthology group: None (inferred from 100% identity to rah:Rahaq_4015)

Predicted SEED Role

"RNase E specificity factor CsrD"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (644 amino acids)

>EX31_RS12230 RNase E specificity factor CsrD (Rahnella sp. WP5)
MRFTTRLSALMTMLVALAMLLMLLGVTFSFIYLNKQDTEQHLQALATTYDQALLTHPPAD
AQRWMPQAMRMLDVTDIEVKLDNTTVFEYHERPDVHRSWDSVMPEYDTAIIPLMHNHAMS
LHISYVDPVSSYIRSLRSTFTIGIAILVMLAMLLLSFRWLRQETDGVEKLEDRAVRILRG
EREGLSGHVGEWPHSASSAIDRLLRDLNEAREQRSRVDTLIRAYAQQDAQTGLSNRLFFD
NQLATQLEEKGAHGVLMLLRLPDFDTMRETHGQAVVEELRSAMVNLLSTFVMRHVDALLA
RYFHSDFAVLLPHRTLKEAEVMASQLVNALGVLPTSSLIDRDALMYIGISAYRFGQTPDQ
VMDMAEQATRHAAFQGSNSWFIYDKNVPEKGRGSVRWRTLLENTLARGGPRLYQKPAFTR
DNKPDHREVQRRVFDGEQELLAAEFIPLVVQFGLSQSFDRVMLSQIIPLLNRWPDETLAF
HLTVDSLLQRSFVRWLRDTLLQCERTQRNRILIELAEADLCQHTDRLRPAIRLLQGLGCR
LAVSQAGLTVVSTSYLKTFPVERVKLHPGLVRDIDKRVENQLFVQSLLSACEGTQALVFA
SGVRTKEEWAVLLKSGIHGGQGDFFAGPEPVEPAGKKYSHNRDV