Protein Info for EX31_RS12190 in Rahnella sp. WP5

Annotation: 50S ribosomal protein L11 methyltransferase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 294 PF06325: PrmA" amino acids 2 to 293 (292 residues), 368.4 bits, see alignment E=1.5e-113 TIGR00406: ribosomal protein L11 methyltransferase" amino acids 3 to 286 (284 residues), 399 bits, see alignment E=6.5e-124 PF01135: PCMT" amino acids 144 to 207 (64 residues), 23.3 bits, see alignment E=2.6e-08 PF05175: MTS" amino acids 144 to 230 (87 residues), 41.4 bits, see alignment E=6e-14 PF13489: Methyltransf_23" amino acids 156 to 230 (75 residues), 30.7 bits, see alignment E=1.3e-10 PF13847: Methyltransf_31" amino acids 159 to 210 (52 residues), 40.7 bits, see alignment 1.1e-13 PF02475: Met_10" amino acids 160 to 214 (55 residues), 21.5 bits, see alignment E=9.1e-08 PF13649: Methyltransf_25" amino acids 162 to 229 (68 residues), 35.5 bits, see alignment E=6.8e-12 PF08242: Methyltransf_12" amino acids 163 to 231 (69 residues), 34 bits, see alignment E=2.1e-11 PF08241: Methyltransf_11" amino acids 164 to 230 (67 residues), 30 bits, see alignment E=3.3e-10

Best Hits

Swiss-Prot: 88% identical to PRMA_YERE8: Ribosomal protein L11 methyltransferase (prmA) from Yersinia enterocolitica serotype O:8 / biotype 1B (strain NCTC 13174 / 8081)

KEGG orthology group: K02687, ribosomal protein L11 methyltransferase [EC: 2.1.1.-] (inferred from 99% identity to rah:Rahaq_4023)

MetaCyc: 86% identical to ribosomal protein L11 methyltransferase (Escherichia coli K-12 substr. MG1655)
RXN0-5419

Predicted SEED Role

"Ribosomal protein L11 methyltransferase (EC 2.1.1.-)" in subsystem Heat shock dnaK gene cluster extended or Ribosome biogenesis bacterial (EC 2.1.1.-)

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 2.1.1.-

Use Curated BLAST to search for 2.1.1.-

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (294 amino acids)

>EX31_RS12190 50S ribosomal protein L11 methyltransferase (Rahnella sp. WP5)
MPWIQLKINTTGNDAETLSDALIESGAVSVTFQDTHDNPVFEPLPGETLLWGDTDAIGLY
DAETDMDEVIAILENEPLLGKGFVHKIEQLEDKDWEREWMDNFHPMRFGERLWICPSWRD
VPDPNAVNVMLDPGLAFGTGTHPTTAMCLQWLDSLDLTDKTVIDFGCGSGILAIAALKLG
AKHVVGIDIDPQAIQASRDNAERNGVSERLSLYLPKDQPDNLSADVVVANILAGPLRELA
PLISVLPVAGGHLGLSGVLASQAQSVADAYKDQFELDPVAEKEEWCRITGVKKA