Protein Info for EX31_RS12170 in Rahnella sp. WP5

Annotation: DoxX family protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 142 transmembrane" amino acids 16 to 35 (20 residues), see Phobius details amino acids 47 to 68 (22 residues), see Phobius details amino acids 80 to 103 (24 residues), see Phobius details amino acids 115 to 135 (21 residues), see Phobius details PF07681: DoxX" amino acids 19 to 96 (78 residues), 64.8 bits, see alignment E=4.7e-22

Best Hits

KEGG orthology group: None (inferred from 99% identity to rah:Rahaq_4027)

Predicted SEED Role

"putative membrane protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (142 amino acids)

>EX31_RS12170 DoxX family protein (Rahnella sp. WP5)
MKQLYLRFTAALNKPDLAILLLRITYGLLIFHGWHKLHDGLGGIQGMLAGYGIPAFVAYG
VIIGEVIAPIMMMLGIFTRLAALSAAATMIVAWLMVGIHHTFALTPVGAWAIEDIVYYFM
AAVVIALYGSGRYSVMSNPLYR