Protein Info for EX31_RS12115 in Rahnella sp. WP5

Annotation: NCS2 family permease

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 455 transmembrane" amino acids 35 to 55 (21 residues), see Phobius details amino acids 62 to 82 (21 residues), see Phobius details amino acids 89 to 108 (20 residues), see Phobius details amino acids 114 to 135 (22 residues), see Phobius details amino acids 147 to 171 (25 residues), see Phobius details amino acids 178 to 202 (25 residues), see Phobius details amino acids 208 to 227 (20 residues), see Phobius details amino acids 257 to 279 (23 residues), see Phobius details amino acids 307 to 327 (21 residues), see Phobius details amino acids 339 to 356 (18 residues), see Phobius details amino acids 363 to 383 (21 residues), see Phobius details amino acids 395 to 423 (29 residues), see Phobius details amino acids 434 to 454 (21 residues), see Phobius details PF00860: Xan_ur_permease" amino acids 32 to 415 (384 residues), 277.5 bits, see alignment E=7.6e-87

Best Hits

Swiss-Prot: 84% identical to GHXQ_ECOLI: Guanine/hypoxanthine permease GhxQ (ghxQ) from Escherichia coli (strain K12)

KEGG orthology group: K06901, putative MFS transporter, AGZA family, xanthine/uracil permease (inferred from 100% identity to rah:Rahaq_4038)

MetaCyc: 84% identical to guanine/hypoxanthine transporter GhxQ (Escherichia coli K-12 substr. MG1655)
TRANS-RXN0-562; TRANS-RXN0-578

Predicted SEED Role

"Guanine-hypoxanthine permease" in subsystem Purine Utilization

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (455 amino acids)

>EX31_RS12115 NCS2 family permease (Rahnella sp. WP5)
MSSQQPQAGRAVAPKGPLDAFFKISARGSNVRQEVIAGLTTFLAMVYSVIVVPSMLGKAG
FSPTAVFVATCLVAGFGSLLMGLWANLPLAIGCAISLTAFTAFSLVLGQHISVPVALGAV
FLMGVLFTIISVTGIRSWILRNLPTGVAHGTGIGIGLFLLLIAANGVGLVVKNPLDGLPV
ALGAFTSFPVVMTLLGLAVIFGLEKLRVPGGILLVIIAISIIGLIFDPTVKYQGLFAMPS
LAGADGKSVIFDLDILGALKAAVLPSVLALVMTAVFDATGTIRAVAGQANLLDENGQIIS
GGKALTADSVSSIFASLVGASPAAVYIESAAGTAAGGKTGLTATVVGVLFLLMLFLSPLS
YLVPAYATAPALMYVGLLMLSNVTKLDFNDFVDAMSGLLCAVFIVLTCNIVTGIMLGFSA
LVIGRIFSGEWRKLNIGTVIIAVALVVFYAGGWAI