Protein Info for EX31_RS12050 in Rahnella sp. WP5

Annotation: DMT family transporter

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 301 signal peptide" amino acids 1 to 19 (19 residues), see Phobius details transmembrane" amino acids 34 to 51 (18 residues), see Phobius details amino acids 63 to 87 (25 residues), see Phobius details amino acids 93 to 111 (19 residues), see Phobius details amino acids 118 to 135 (18 residues), see Phobius details amino acids 147 to 165 (19 residues), see Phobius details amino acids 185 to 206 (22 residues), see Phobius details amino acids 212 to 234 (23 residues), see Phobius details amino acids 243 to 261 (19 residues), see Phobius details amino acids 267 to 287 (21 residues), see Phobius details PF00892: EamA" amino acids 4 to 134 (131 residues), 49.8 bits, see alignment E=2e-17 amino acids 150 to 285 (136 residues), 52.5 bits, see alignment E=3e-18

Best Hits

KEGG orthology group: None (inferred from 100% identity to rah:Rahaq_4051)

Predicted SEED Role

"Permease of the drug/metabolite transporter (DMT) superfamily" in subsystem Queuosine-Archaeosine Biosynthesis

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (301 amino acids)

>EX31_RS12050 DMT family transporter (Rahnella sp. WP5)
MNALLYILVILIWGTTWFAIYLQQGDVPVTVSVFYRFLLAAVIMLVALLATRRLRRLALK
DHLFCLVQGCCVFCFNFYCFYHAAAYITSGLESVIFSMAVLFNAFNGMLFFRQKLAPAVI
PASVLGLAGIITLFWHDLSAAHIAPELLKGIGLSLLGTYGFSLGNMISSRHQRHGLDVLS
TNTYAMFYGTAVMGALSLMQGASFAIDLTPQYLGSLVYLSVFGSVLAFGIYFTLVGRIGA
SQAAYSTLLFPLVALTVSTFYENYQWHANAVIGLALILLGNLVMFCRPAWLEMFRRKAAA
A