Protein Info for EX31_RS11985 in Rahnella sp. WP5

Annotation: AAA family ATPase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 446 PF13476: AAA_23" amino acids 6 to 195 (190 residues), 69 bits, see alignment E=2.8e-22 PF02463: SMC_N" amino acids 25 to 355 (331 residues), 44.8 bits, see alignment E=3.1e-15 PF13304: AAA_21" amino acids 32 to 348 (317 residues), 78.8 bits, see alignment E=2.4e-25 PF13175: AAA_15" amino acids 190 to 348 (159 residues), 44.4 bits, see alignment E=5.3e-15

Best Hits

KEGG orthology group: None (inferred from 59% identity to ecm:EcSMS35_2489)

Predicted SEED Role

"ATP binding protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (446 amino acids)

>EX31_RS11985 AAA family ATPase (Rahnella sp. WP5)
MEIKNIRLINVGRFEDLEIALSPTENCTGNTTVFVGNNGAGKTSLLKSIATSLSWFISRI
RSEKGNGSPVSEDVILNGQNSASIELEVLDAHVGKSFTWAIAKTRAGRKAVFQTHLSSLS
ALTDIYRTKLSDNDKTALPLIAFYPVERAVLDIPLKIREKHTFTQLDGYDNSLSQGVDFR
RFFEWFREREDSENERGFTEESFEAMTKIIGENHASIVKLNELRDAAKDKQLTAVRSAIH
HFMPGFTNIRVRRKPRLHMTIDKQGETLSVSQLSQGEKSLMALVGDIARRLAIMNPASNN
PLSGDGIILIDEVDMHLHPQWQRSLIERLTSTFPNCQFILSTHSPLVIRDYKDVLVYSLE
NGQSKEVSTQYGQDANSVLLDVMDTDIRNNHINIRLNDLLDAIHDKKIDAARSIINELET
VLPASNIELIRARLLLRKQELRREES