Protein Info for EX31_RS11820 in Rahnella sp. WP5

Annotation: phosphate-starvation-inducible protein PsiE

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 135 transmembrane" amino acids 12 to 34 (23 residues), see Phobius details amino acids 54 to 75 (22 residues), see Phobius details amino acids 85 to 103 (19 residues), see Phobius details amino acids 110 to 127 (18 residues), see Phobius details PF06146: PsiE" amino acids 17 to 128 (112 residues), 72.8 bits, see alignment E=1.5e-24

Best Hits

Swiss-Prot: 74% identical to PSIE_SERP5: Protein PsiE homolog (psiE) from Serratia proteamaculans (strain 568)

KEGG orthology group: K13256, protein PsiE (inferred from 100% identity to rah:Rahaq_4099)

Predicted SEED Role

"PsiE protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (135 amino acids)

>EX31_RS11820 phosphate-starvation-inducible protein PsiE (Rahnella sp. WP5)
MAGSKRALMISVIMQRILNVFLLGLAAILMIFIGRETYHLAMVLFVNNDQSSSYLLIEGI
VIYFLYFEFIALIIKYFSSGYHFPLRYFIYIGITAIIRLIIVDHKSPYDTLVYACAILVL
VVTLFLANSERLRRE