Protein Info for EX31_RS11685 in Rahnella sp. WP5

Annotation: YebC/PmpR family DNA-binding transcriptional regulator

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 247 TIGR01033: DNA-binding regulatory protein, YebC/PmpR family" amino acids 1 to 237 (237 residues), 348.3 bits, see alignment E=1.2e-108 PF20772: TACO1_YebC_N" amino acids 5 to 75 (71 residues), 102.2 bits, see alignment E=1.7e-33 PF01709: Transcrip_reg" amino acids 82 to 236 (155 residues), 210.7 bits, see alignment E=1e-66

Best Hits

Swiss-Prot: 92% identical to Y2779_SERP5: Probable transcriptional regulatory protein Spro_2779 (Spro_2779) from Serratia proteamaculans (strain 568)

KEGG orthology group: None (inferred from 100% identity to rah:Rahaq_1715)

Predicted SEED Role

"FIG000859: hypothetical protein" in subsystem RuvABC plus a hypothetical

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (247 amino acids)

>EX31_RS11685 YebC/PmpR family DNA-binding transcriptional regulator (Rahnella sp. WP5)
MAGHSKWANTKHRKAAQDSKRGKIFTKIIRELVTAARLGGGDAGSNPRLRAAIDKALSNN
MTRDTLNRAIARGVGGDEDTNMETIIYEGYGPGGSAIMVECLSDNRNRTVAEVRHAFTKT
GGNLGTDGSVAYLFSKKGVITFAPGLDEDVLMEAALEAGAEDIISYDDGAIDVFTAWENL
GEVKDALEAAGYKADSAEVTMIPSTKADMDAETAPKLLRLIDMLEDCDDVQEVYHNGEIS
DEIAETL