Protein Info for EX31_RS11525 in Rahnella sp. WP5

Annotation: UTP--glucose-1-phosphate uridylyltransferase GalU

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• TIGR01099: UTP--glucose-1-phosphate uridylyltransferase
  • amino acids 3 to 270 (268 residues), 380.5 bits, E=2.3e-118
• PF00483: NTP_transferase
  • amino acids 3 to 271 (269 residues), 97.4 bits, E=5.1e-32

Best Hits

Swiss-Prot: 75% identical to GALU_SHIFL: UTP--glucose-1-phosphate uridylyltransferase (galU) from Shigella flexneri

KEGG orthology group: K00963, UTP--glucose-1-phosphate uridylyltransferase [EC: 2.7.7.9] (inferred from 100% identity to rah:Rahaq_1748)

MetaCyc: 75% identical to UTP--glucose-1-phosphate uridylyltransferase (Escherichia coli K-12 substr. MG1655)
UTP-monosaccharide-1-phosphate uridylyltransferase. [EC: 2.7.7.64, 2.7.7.9]

Predicted SEED Role

"UTP--glucose-1-phosphate uridylyltransferase (EC 2.7.7.9)" (EC 2.7.7.9)

MetaCyc Pathways

• superpathway of anaerobic sucrose degradation (18/19 steps found)
• stachyose degradation (7/7 steps found)
• colanic acid building blocks biosynthesis (9/11 steps found)
• D-galactose detoxification (3/3 steps found)
• UDP-α-D-glucose biosynthesis (2/2 steps found)
• sucrose biosynthesis I (from photosynthesis) (7/9 steps found)
• sucrose degradation II (sucrose synthase) (4/5 steps found)
• sucrose biosynthesis II (6/8 steps found)
• superpathway of UDP-glucose-derived O-antigen building blocks biosynthesis (4/6 steps found)
• type I lipoteichoic acid biosynthesis (S. aureus) (5/17 steps found)

KEGG Metabolic Maps

• Galactose metabolism
• Nucleotide sugars metabolism
• Pentose and glucuronate interconversions
• Starch and sucrose metabolism

Isozymes

No predicted isozymes

Use Curated BLAST to search for 2.7.7.64 or 2.7.7.9

Protein Sequence (295 amino acids)

>EX31_RS11525 UTP--glucose-1-phosphate uridylyltransferase GalU (Rahnella sp. WP5)
MLKAVIPVAGLGTRMLPATKAIPKEMLPIVDKPLIQYIVNECAAAGIKEIILVTHSSKNA
IENHFDTSFELESMLESRVKRQLLEEVQSICPKGVTIMNVRQGQSKGLGHAVLCAKPLIG
NSPFAVILPDVLMDDSTSDLRKDNLAAMLRRFQETGNSQVMVEEVPEKDVSKYGIVNCNG
VEVEPGESAPMTAIVEKPELKDAPSNLAVVGRYVLSEAIWPLLAVTPYGAGNEIQLTDAI
AMLMKKHTVEAFSMTGRSHDCGDKLGYMKAFVEYGIRHNTQGEAFKAWLKEFAEE