Protein Info for EX31_RS11480 in Rahnella sp. WP5

Annotation: ABC transporter permease

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 272 transmembrane" amino acids 41 to 65 (25 residues), see Phobius details amino acids 77 to 98 (22 residues), see Phobius details amino acids 118 to 145 (28 residues), see Phobius details amino acids 153 to 175 (23 residues), see Phobius details amino acids 187 to 208 (22 residues), see Phobius details amino acids 240 to 261 (22 residues), see Phobius details PF01061: ABC2_membrane" amino acids 22 to 232 (211 residues), 95.9 bits, see alignment E=1.2e-31

Best Hits

KEGG orthology group: K09690, lipopolysaccharide transport system permease protein (inferred from 70% identity to pfo:Pfl01_4049)

Predicted SEED Role

"O-antigen export system permease protein RfbD"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (272 amino acids)

>EX31_RS11480 ABC transporter permease (Rahnella sp. WP5)
MQSFNASPREFVASAVRNRALIYNLVKREVVGRYKGSMLGILWSFFNPVFMLAVYTFVFS
VVFNARWAGGGQSKTEFALILFAGLIVFNLFADCFNRAPGLVLANANYVKKVVFPLEILP
WVSVGSALFHAMISIIVWVIFYIFVVGVPHLTILLLPITIIPLVLLSVGVSWALASLGVY
LRDVSQLVAVLTTVLMFLSPIFFPIEALPEHYRPLLKMNPLAPAIAEMRDVLYFGGIPKI
SSFCIYFAACSLVAWLGFAWFQKTRKGFADVL