Protein Info for EX31_RS11420 in Rahnella sp. WP5

Annotation: flagellar transcriptional regulator FlhC

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 202 PF05280: FlhC" amino acids 12 to 182 (171 residues), 290.4 bits, see alignment E=2.2e-91

Best Hits

Swiss-Prot: 91% identical to FLHC_YEREN: Flagellar transcriptional regulator FlhC (flhC) from Yersinia enterocolitica

KEGG orthology group: K02402, flagellar transcriptional activator FlhC (inferred from 100% identity to rah:Rahaq_1771)

Predicted SEED Role

"Flagellar transcriptional activator FlhC" in subsystem Flagellum

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (202 amino acids)

>EX31_RS11420 flagellar transcriptional regulator FlhC (Rahnella sp. WP5)
MSGKDASTKPAEKSIVQEARDIQLAMELITLGARLQMLESETQLSRGRLIKLYKELRGSP
PPKGMLPFSTDWFMTWEQNIHSSMFYNAYSFLLKSGHCNGVEAVIKAYRLYLEQCPEQPG
EAPILALTRAWTLVRFVDSGMLQLSACNCCDGSFITHAHQPRHGFVCSLCQPPSRAVKKR
KLSPQVADITSQELDEQVKHAV