Protein Info for EX31_RS11415 in Rahnella sp. WP5

Annotation: flagellar motor stator protein MotA

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 296 transmembrane" amino acids 5 to 23 (19 residues), see Phobius details amino acids 28 to 29 (2 residues), see Phobius details amino acids 32 to 49 (18 residues), see Phobius details amino acids 70 to 87 (18 residues), see Phobius details amino acids 171 to 191 (21 residues), see Phobius details amino acids 198 to 220 (23 residues), see Phobius details TIGR03818: flagellar motor stator protein MotA" amino acids 1 to 282 (282 residues), 396.5 bits, see alignment E=2.9e-123 PF20560: MotA_N" amino acids 4 to 93 (90 residues), 117.7 bits, see alignment E=2.1e-38 PF01618: MotA_ExbB" amino acids 135 to 239 (105 residues), 51.4 bits, see alignment E=9.2e-18

Best Hits

Swiss-Prot: 79% identical to MOTA_SALTY: Motility protein A (motA) from Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720)

KEGG orthology group: K02556, chemotaxis protein MotA (inferred from 100% identity to rah:Rahaq_1772)

Predicted SEED Role

"Flagellar motor rotation protein MotA" in subsystem Flagellar motility or Flagellum

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (296 amino acids)

>EX31_RS11415 flagellar motor stator protein MotA (Rahnella sp. WP5)
MLVIIGYIVVLGSVFGGFMLVGGELGALYQPAELLIIGGAGIGAFFVGNNGKAIKSTMRA
LPQLFRASKYNKALYMDLMALLYRVLAKSRQQGMLSLENDIDNPAESDIFANYPRILADK
QLVEYLTDYLRLMVSGNMNAFEIEALMDEEIETYEHESEVPANSLALVGDSLPAFGIVAA
VMGIVHTLAAADRPAAELGALIAHAMVGTFLGILLAYGFISPLASVLRQKSAENAKMMQC
IKVTLLSSINGYAPQIAVEFGRKTLYTSERPSFIELEEHVRQVKSPGQKQTEEEKV