Protein Info for EX31_RS11340 in Rahnella sp. WP5

Annotation: flagellar biosynthesis protein FlhA

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 600 650 694 transmembrane" amino acids 21 to 39 (19 residues), see Phobius details amino acids 46 to 64 (19 residues), see Phobius details amino acids 71 to 92 (22 residues), see Phobius details amino acids 117 to 140 (24 residues), see Phobius details amino acids 209 to 231 (23 residues), see Phobius details amino acids 251 to 272 (22 residues), see Phobius details amino acids 289 to 305 (17 residues), see Phobius details amino acids 308 to 327 (20 residues), see Phobius details TIGR01398: flagellar biosynthesis protein FlhA" amino acids 22 to 691 (670 residues), 923.5 bits, see alignment E=3.6e-282 PF00771: FHIPEP" amino acids 31 to 682 (652 residues), 885.2 bits, see alignment E=1.5e-270

Best Hits

Swiss-Prot: 85% identical to FLHA_YEREN: Flagellar biosynthesis protein FlhA (flhA) from Yersinia enterocolitica

KEGG orthology group: K02400, flagellar biosynthesis protein FlhA (inferred from 83% identity to ect:ECIAI39_1171)

Predicted SEED Role

"Flagellar biosynthesis protein FlhA" in subsystem Flagellar motility or Flagellum

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (694 amino acids)

>EX31_RS11340 flagellar biosynthesis protein FlhA (Rahnella sp. WP5)
MANLAAILRLPANFKSGQWQVLAGPILILIILSMMVLPLPPFILDLLFTFNIALSIMVLL
VAMFTQRTLDFAAFPTILLFSTLLRLSLNVASTRVILLEGHTGGAAAGRVIEAFGHFLVG
GNFAIGIVVFIILVLINFMVITKGAGRIAEVGARFVLDGMPGKQMAIDADLNAGLIGEDE
AKKRRSDVTQEADFYGSMDGASKFVRGDAVAGLMIMIINVVGGLLVGVLQHGMDLGHAAE
SYTLLTIGDGLVAQIPALVISTAAGVIVTRVGTNEDVGEQMVTQLFRNPRVMMLSAGVLG
LLGMVPGMPNFVFLMFTAGLLALAWWTRGQELKKPTTAAAAPAVADNGKQMVEASWQDVQ
LEDPLGMEVGYRLIPMVDFAQNGELLGRIRSIRKKFAQEMGYLPPVIHIRDNLELPPAGY
RILMKGVEIGTGAAHPGRWMAINPGSAIGELPGEATVDPAFGLAAVWIEPAMREQAQIQG
YTVVEASTVVATHLNHLISMHAKELFGRQETQELMERVTKEMPKLTEDFIPGIISLTNMH
KVLQNLLSERVSIRDMRTIVETLAEYAPNQPDPNELTSVVRVALGRAITQQWFPGSGEVQ
VIGLDTSLERLLLQALQSGGGLEPGLAERLLTQSEAALQRQDMLSAPPVLLVNHALRPLL
SRFLRRSLPNIVVMSNLEMSDSRQIRMTATIGGE