Protein Info for EX31_RS11245 in Rahnella sp. WP5

Annotation: amino acid ABC transporter permease

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 304 transmembrane" amino acids 21 to 43 (23 residues), see Phobius details amino acids 69 to 90 (22 residues), see Phobius details amino acids 101 to 124 (24 residues), see Phobius details amino acids 153 to 167 (15 residues), see Phobius details amino acids 225 to 245 (21 residues), see Phobius details amino acids 251 to 276 (26 residues), see Phobius details TIGR01726: amino ABC transporter, permease protein, 3-TM region, His/Glu/Gln/Arg/opine family" amino acids 60 to 175 (116 residues), 53.9 bits, see alignment E=1.1e-18 PF00528: BPD_transp_1" amino acids 80 to 278 (199 residues), 58.9 bits, see alignment E=2.9e-20

Best Hits

KEGG orthology group: K02029, polar amino acid transport system permease protein (inferred from 100% identity to rah:Rahaq_1857)

Predicted SEED Role

"Amino acid ABC transporter permease protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (304 amino acids)

>EX31_RS11245 amino acid ABC transporter permease (Rahnella sp. WP5)
MSENAPSSVNHPPLKVVPARYPWRLAGAVFSAFILLGIIQSIATNSRWEWGVFRQWFFDP
VILSGLGKTLLLTLLGTLFGVIFGTALALARLSKSYLLNALAWGYIWLFRSLPLLLVLII
LYNFSYLYDNLSLGIPFTTISFFSTPTVDLLDQFSVAVLGLSLVQSAYTAEIIRGGILGV
EHGQHEAAAALGLPAYRRTFRIILPQALRSILPTGFNEVISLAKGTSIVYVLSMPELFYT
VQVIYNRTQQVIPLLMVATIWYLLITTVLSVLQYYVERYFSRGTVRQVAPTPLQRLRQWR
VARS