Protein Info for EX31_RS11230 in Rahnella sp. WP5

Annotation: amidohydrolase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 394 TIGR01891: amidohydrolase" amino acids 25 to 373 (349 residues), 396.3 bits, see alignment E=7.2e-123 PF01546: Peptidase_M20" amino acids 81 to 385 (305 residues), 149.1 bits, see alignment E=1.7e-47 PF07687: M20_dimer" amino acids 193 to 286 (94 residues), 41.1 bits, see alignment E=1.5e-14

Best Hits

Swiss-Prot: 50% identical to YXEP_BACSU: Uncharacterized hydrolase YxeP (yxeP) from Bacillus subtilis (strain 168)

KEGG orthology group: None (inferred from 99% identity to rah:Rahaq_1860)

MetaCyc: 50% identical to N-acetyl-sulfur-metabolite deacetylase (Bacillus subtilis subtilis 168)
3.5.1.-

Predicted SEED Role

"N-acetyl-L,L-diaminopimelate deacetylase homolog (EC 3.5.1.18)" (EC 3.5.1.18)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 3.5.1.18

Use Curated BLAST to search for 3.5.1.18

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (394 amino acids)

>EX31_RS11230 amidohydrolase (Rahnella sp. WP5)
MSISLAEETNSIAPRHETGLEEQLIAYRRELHQHPELSNQEFVTTQKITQWLNAAGIRIL
SLGLKTGVVAEIRPAHGPVVALRGDIDALPIEEASGVPFSSQQPGVMHACGHDFHTSVIL
GAAHLLKAREDQLPGRVRLFFQPAEERFGGASQLIKAGALENVDAIFGLHNAPELPVGTF
ETKGGAFYANVDRFQITVTGKGAHAAHPEEGTDSIVTASHIVTALQTVVSRNVSAQEAAV
VSVTRIEGGNTWNVLPQTVELEGTVRTYSNGIREQIPQRIRKVINGVADALGAKAELHWF
GGPPAVVNTPRWADFALQAAAEFGYNAQVAQAQMGGEDFAFYLHHVPGAFVSIGSASDFG
LHHPQFNPDESAIYPAANYFQQLAEKALSELTGK