Protein Info for EX31_RS11200 in Rahnella sp. WP5

Annotation: alpha/beta fold hydrolase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 260 PF03096: Ndr" amino acids 11 to 119 (109 residues), 26.5 bits, see alignment E=5.2e-10 PF00561: Abhydrolase_1" amino acids 22 to 130 (109 residues), 65.5 bits, see alignment E=1.3e-21 PF12146: Hydrolase_4" amino acids 23 to 239 (217 residues), 52.6 bits, see alignment E=8.2e-18 PF12697: Abhydrolase_6" amino acids 23 to 248 (226 residues), 75.7 bits, see alignment E=1.8e-24

Best Hits

KEGG orthology group: K01055, 3-oxoadipate enol-lactonase [EC: 3.1.1.24] (inferred from 99% identity to rah:Rahaq_1867)

Predicted SEED Role

"Beta-ketoadipate enol-lactone hydrolase (EC 3.1.1.24)" in subsystem Catechol branch of beta-ketoadipate pathway or Chloroaromatic degradation pathway or Protocatechuate branch of beta-ketoadipate pathway (EC 3.1.1.24)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 3.1.1.24

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (260 amino acids)

>EX31_RS11200 alpha/beta fold hydrolase (Rahnella sp. WP5)
MFIRPLKLTQHVDVQGSDNATTLVLLHSLGTDLHLWDLQMPRLSERYRVIRLDIRGHGLS
AVDSLQFSMSDLADDVVAALDHLHINEFYVAGVSIGGTIAQWIGFKIPKRVQGMIIVDTA
LVNAAPPSLWRARAEDVFHHGVEHLEMGILSKWVTPKFIDSPYAEGMKQMLRRTSVEAFA
GCSYAIADTDLTDMNIPGVRAVVVRGSEDQLTPPDYAQRLADKRNAQLHTLPGAAHLPNY
EQPEALTDEIISFIDNKNTH