Protein Info for EX31_RS11130 in Rahnella sp. WP5

Annotation: ABC transporter permease

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 271 transmembrane" amino acids 18 to 39 (22 residues), see Phobius details amino acids 65 to 93 (29 residues), see Phobius details amino acids 102 to 124 (23 residues), see Phobius details amino acids 130 to 148 (19 residues), see Phobius details amino acids 183 to 207 (25 residues), see Phobius details amino acids 231 to 254 (24 residues), see Phobius details PF00528: BPD_transp_1" amino acids 82 to 258 (177 residues), 99.7 bits, see alignment E=9e-33

Best Hits

Swiss-Prot: 31% identical to Y355_HAEIN: Probable ABC transporter permease protein HI_0355 (HI_0355) from Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd)

KEGG orthology group: K02050, sulfonate/nitrate/taurine transport system permease protein (inferred from 100% identity to rah:Rahaq_1884)

Predicted SEED Role

"Hydroxymethylpyrimidine ABC transporter, transmembrane component" in subsystem Thiamin biosynthesis

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (271 amino acids)

>EX31_RS11130 ABC transporter permease (Rahnella sp. WP5)
MQTQKSSPWINNQTFRKVLYPAVVAIVVVLLWQGWVSYFKIPQFLVPSPVVMLESLWTNF
GTLTMSLLFTLKITLISFLLSIVIGSVVAFVLVQNRFVETALFPYIVFLQVTPIVAIAPL
IIIWVKDTTLSLVVCSTLMAVFPIISNTTQGLRSVSPGLLSYFQLSRASRLQILIRLRIP
SALPYFFGALRISSGLSLIGAVVAEFVAGTGGNNTGLAYQILQAGYQLDIPLMFAALLLI
SLTGIALFGVMSWISRRALSAWHESEAVQSH