Protein Info for EX31_RS10970 in Rahnella sp. WP5

Annotation: DUF979 domain-containing protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 316 transmembrane" amino acids 6 to 23 (18 residues), see Phobius details amino acids 32 to 48 (17 residues), see Phobius details amino acids 54 to 73 (20 residues), see Phobius details amino acids 97 to 117 (21 residues), see Phobius details amino acids 128 to 148 (21 residues), see Phobius details amino acids 168 to 192 (25 residues), see Phobius details amino acids 199 to 220 (22 residues), see Phobius details amino acids 226 to 246 (21 residues), see Phobius details amino acids 252 to 277 (26 residues), see Phobius details amino acids 294 to 314 (21 residues), see Phobius details PF06166: DUF979" amino acids 6 to 314 (309 residues), 400.4 bits, see alignment E=2.8e-124

Best Hits

KEGG orthology group: None (inferred from 99% identity to rah:Rahaq_1920)

Predicted SEED Role

"FIG001614: Membrane protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (316 amino acids)

>EX31_RS10970 DUF979 domain-containing protein (Rahnella sp. WP5)
MITLQTVYILAGLMFCAYAFFNVRDKSHSRRYVNALFWGIYGVTFLFGAELPHFVTGCMA
ILLAVIAGSGKLGKGKSDSEQPGQVEKREAGAKRFGNRLFIPALLIPIVTLIGTLTLKYT
PLVEAKNVTLISLVLGTLVAFIVALIMLRDSPVKAVKAGGQTMDTVGWAAILPQMLAALG
ALFALAGVGGVVSELVKNIIPLGSPLAIVIAYTFGMALFTMIMGNGFAAFPVMTAGIGLP
LIVNQLGGNPAIMGAIGMLSGFCGTLMTPMAANFNIVPAALLELQDKNGVIKAQWKTGVL
LLLVNTAFMYFFVFRF