Protein Info for EX31_RS10840 in Rahnella sp. WP5

Annotation: efflux RND transporter periplasmic adaptor subunit

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 414 signal peptide" amino acids 1 to 38 (38 residues), see Phobius details PF19335: HMBD" amino acids 46 to 72 (27 residues), 42 bits, see alignment (E = 2.2e-14) PF16576: HlyD_D23" amino acids 107 to 313 (207 residues), 208.4 bits, see alignment E=2.4e-65 PF16572: HlyD_D4" amino acids 152 to 203 (52 residues), 60.3 bits, see alignment 4e-20 TIGR01730: efflux transporter, RND family, MFP subunit" amino acids 210 to 388 (179 residues), 127.1 bits, see alignment E=3.7e-41 PF13437: HlyD_3" amino acids 211 to 311 (101 residues), 54.5 bits, see alignment E=5.1e-18

Best Hits

KEGG orthology group: K07798, Cu(I)/Ag(I) efflux system membrane protein CusB (inferred from 99% identity to rah:Rahaq_1948)

Predicted SEED Role

"Cobalt/zinc/cadmium efflux RND transporter, membrane fusion protein, CzcB family" in subsystem Cobalt-zinc-cadmium resistance

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (414 amino acids)

>EX31_RS10840 efflux RND transporter periplasmic adaptor subunit (Rahnella sp. WP5)
MTSAKTYSLLAVAIMAALAAGYVAGRHSPAAQTQASAAPAERKVLYWYDPMTPGQRFDKP
GKSPFMDMDLMPRYADEVTDDGGVTVSARQQQNLGMRSEKVQRRMISAPLNVYGTVSADE
RSLRTVAARANGLVEKLYVAASQQPVKKGQKLATLWIPDWTAAQQEYLAVRQLGDRSLTA
AARQRLALQFMPEDILRHVDKTGQPQTRIDVVAPEDGYISLLSVREGAQVSATQPLFELT
SLKQVWIVMDYPPSAASQIQIGGKITASADSQPGEIFHGTVSELLPDVDAVSRTLKARVV
IDNPQEKLRPGMYLNLSPDVSAQTAVLAIAQEALIQTGSRNTVLLDDGNGHFTPQKVTIG
VTRDGWTQVLSGLEEGQSVVTSGQFLIDSEASLRSALPATDAPAPDTHQHGGDL