Protein Info for EX31_RS10820 in Rahnella sp. WP5

Annotation: magnesium/cobalt transporter CorA

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 335 transmembrane" amino acids 278 to 297 (20 residues), see Phobius details amino acids 308 to 327 (20 residues), see Phobius details TIGR00383: magnesium and cobalt transport protein CorA" amino acids 34 to 335 (302 residues), 208.9 bits, see alignment E=6.1e-66 PF01544: CorA" amino acids 45 to 331 (287 residues), 212.3 bits, see alignment E=5.1e-67

Best Hits

KEGG orthology group: K03284, metal ion transporter, MIT family (inferred from 100% identity to rah:Rahaq_1952)

Predicted SEED Role

"Magnesium and cobalt transport protein CorA" in subsystem Campylobacter Iron Metabolism

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (335 amino acids)

>EX31_RS10820 magnesium/cobalt transporter CorA (Rahnella sp. WP5)
MNSISNEDKKPSCDSVINSVAYRDGKRLQDVTVEDISEVLKEPDTFVWLGLWQPEDAYMR
SIQEEFGLHDLAIEDALTAHQRPKIEQYGESLFIVTHTAQKVNETIEYGETHLFLGKNFL
ITVRHGASSSYKEIRKHAEERPEMLSKGPAYALYCVLDSIVDNYLEILHQYTEQFDAIEK
LMFRNTFNQQAVQQVYSLRRDLLSLRNAAVPMEDICNQLSHHYEELMPKSLRAYVRDVQD
HANQVIRTTDDVREMLSNAMHVNLALVSVHQNEVVQRLAGWGAILAIPTVIFSLYGMNFK
NMPELDDWWGYPVTLGVTVAGCVWLYWKLKKSGWL