Protein Info for EX31_RS10795 in Rahnella sp. WP5

Annotation: HlyD family secretion protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 396 transmembrane" amino acids 59 to 79 (21 residues), see Phobius details PF00529: CusB_dom_1" amino acids 70 to 388 (319 residues), 26.8 bits, see alignment E=7.9e-10 PF16576: HlyD_D23" amino acids 91 to 341 (251 residues), 63 bits, see alignment E=5e-21 PF13533: Biotin_lipoyl_2" amino acids 96 to 142 (47 residues), 55.2 bits, see alignment 9.4e-19 PF13437: HlyD_3" amino acids 268 to 354 (87 residues), 52.4 bits, see alignment E=1.6e-17

Best Hits

KEGG orthology group: K03543, multidrug resistance protein A (inferred from 100% identity to rah:Rahaq_1957)

Predicted SEED Role

"Membrane fusion component of tripartite multidrug resistance system" in subsystem Multidrug Resistance, Tripartite Systems Found in Gram Negative Bacteria

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (396 amino acids)

>EX31_RS10795 HlyD family secretion protein (Rahnella sp. WP5)
MTNDNKTQPSASGDANTELDSSQVKSGGGHTQDPKDQKNPDDSKQDNDEKRKGPGKKPLI
ILGIVVVVMVVVALVWWLMTKDQVSTDDAFTEGDAVTIAPKIAGYVTHLAVKDNQFVKKG
DLLVEIDPRDATAQRDQAQAQLGLAVAQLHQAQAQYDLAKVQYPAQLAQAKAQQTRAEAN
LLNATADFRRQRGVDPRATTQQNIDTSNAQVRSAAADLENAKAQVQVAAQVQLNIRQAET
NVEARQQQVEQAKAQLETATLNLSYAQVRAPFDGYVTKRNVQLGTLVQAGTSLFSVVSKD
IWIAANYKESQLERMRPGNKVEITVDAFPDIKLHGHVDSIQQGTGSRFSAFPAENATGNY
VKIVQRVPVKIVIDSGLDENHPLPLGLSVEPTVTVE