Protein Info for EX31_RS10720 in Rahnella sp. WP5

Annotation: NAD(P)H:quinone oxidoreductase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• TIGR01755: NAD(P)H:quinone oxidoreductase, type IV
  • amino acids 32 to 227 (196 residues), 315.3 bits, E=9.3e-99
• PF03358: FMN_red
  • amino acids 33 to 173 (141 residues), 54.5 bits, E=1.5e-18
• PF00258: Flavodoxin_1
  • amino acids 36 to 153 (118 residues), 44.1 bits, E=3.7e-15

Best Hits

Swiss-Prot: 81% identical to NQOR_SERP5: NAD(P)H dehydrogenase (quinone) (Spro_1813) from Serratia proteamaculans (strain 568)

KEGG orthology group: K03809, Trp repressor binding protein (inferred from 99% identity to rah:Rahaq_1974)

MetaCyc: 80% identical to NAD(P)H:quinone oxidoreductase (Escherichia coli K-12 substr. MG1655)
NAD(P)H dehydrogenase (quinone). [EC: 1.6.5.2]

Predicted SEED Role

"Flavoprotein WrbA"

MetaCyc Pathways

• superpathway of photosynthetic hydrogen production (3/6 steps found)
• vitamin K-epoxide cycle (1/4 steps found)

Isozymes

Compare fitness of predicted isozymes for: 1.6.5.2

Use Curated BLAST to search for 1.6.5.2

Protein Sequence (229 amino acids)

>EX31_RS10720 NAD(P)H:quinone oxidoreductase (Rahnella sp. WP5)
MGFLSEFFARITGSKTGQDTVKTSPQQELKMAKVLVLYHSMYGHIETMAQSVAEGARSVP
GVEVTIKRVPETMPEEAFKAAGGKTGQTAEIASPAELADYDAIIFGTPTRFGNMTGQMRT
FLDQTGGLWAKGALAGKVASVFSSTGTGGGQEMTITSTWTTLAHHGMIIVPIGYTTPELF
DISQVRGGTPYGATTIAGGDGSRQPSAEELRIAVHQGKHVATIVSKLVS