Protein Info for EX31_RS10690 in Rahnella sp. WP5

Annotation: sodium:proton antiporter

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 459 signal peptide" amino acids 1 to 23 (23 residues), see Phobius details transmembrane" amino acids 32 to 50 (19 residues), see Phobius details amino acids 54 to 80 (27 residues), see Phobius details amino acids 91 to 114 (24 residues), see Phobius details amino acids 120 to 142 (23 residues), see Phobius details amino acids 164 to 184 (21 residues), see Phobius details amino acids 196 to 216 (21 residues), see Phobius details amino acids 233 to 262 (30 residues), see Phobius details amino acids 323 to 341 (19 residues), see Phobius details amino acids 347 to 369 (23 residues), see Phobius details amino acids 380 to 399 (20 residues), see Phobius details amino acids 411 to 434 (24 residues), see Phobius details PF00999: Na_H_Exchanger" amino acids 15 to 270 (256 residues), 84 bits, see alignment E=5.1e-28 amino acids 320 to 436 (117 residues), 42.4 bits, see alignment E=2.1e-15

Best Hits

KEGG orthology group: None (inferred from 100% identity to rah:Rahaq_1986)

Predicted SEED Role

"FIG00634981: hypothetical protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (459 amino acids)

>EX31_RS10690 sodium:proton antiporter (Rahnella sp. WP5)
MGFLGWTAAVGGLLLIMSLASGWISRGPVTTFGLYLAAGIVCGPWVLDLLHIDLVAYSTL
TAHFTEIAMAASLFITGLKLRLPFRAQSWRVGVLLAFPAMLLTVLCVAAIAHYITGISWP
LALALGAIIAPTDPVLASMIAVNDANDDDGLRVALSSEAGMNDGSALPILMLALMLFTAH
EGLSSQELWHWAWRDVVWALLGGLAIGFAMGKLVGLSATRFHSRQRTVAPSDFLALSLIA
LSYAAAQSLDASGFLAAFAAGVGLRSAEVRVVSLHPPEDLTDGSRPPPAEGMVNPHQRHS
MQAEMPRNSIGLMVGDALSFGDTIERIFAAGIVMVLGITLSEHWEPMGLLIAALLFIVIR
PLAVYITTIGVHVPKGRRLMIGWFGIRGIGSMNYIAYAWTHGLHGADANYMTNIAFTVIV
TSVVIHGITVSPVLHWRQARQEAAQEEREAREKSQEEKA