Protein Info for EX31_RS10570 in Rahnella sp. WP5

Annotation: lytic murein transglycosylase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• TIGR02283: lytic murein transglycosylase
  • amino acids 61 to 358 (298 residues), 390.4 bits, E=2.6e-121
• PF13406: SLT_2
  • amino acids 62 to 355 (294 residues), 355.4 bits, E=1.1e-110

Best Hits

KEGG orthology group: K08305, membrane-bound lytic murein transglycosylase B [EC: 3.2.1.-] (inferred from 99% identity to rah:Rahaq_2010)

Predicted SEED Role

"Membrane-bound lytic murein transglycosylase B (EC 3.2.1.-)" in subsystem Peptidoglycan Biosynthesis (EC 3.2.1.-)

KEGG Metabolic Maps

• Ascorbate and aldarate metabolism
• Glycosaminoglycan degradation
• Nucleotide sugars metabolism
• Ubiquinone and menaquinone biosynthesis

Isozymes

Compare fitness of predicted isozymes for: 3.2.1.-

Use Curated BLAST to search for 3.2.1.-

Protein Sequence (391 amino acids)

>EX31_RS10570 lytic murein transglycosylase (Rahnella sp. WP5)
MKLSALAVLTPLIILSGCAAQKATSGQPSTPSTAATQPAAAAPAAPSGKTSLAEQGRDPA
EFPAYVEQLKAQALSQGISQQTIDSTFANIHFVDRVINSDRNQLEKKITLDDYLTRVLPE
WKIKQGQEQLQSNLPALTKASERYGVQPQYIVALWAMESSFGKIQGKEDVFSALATLAFE
GRREAFFTKEFMSALKIVDSGKATSDMMKGSWAGAMGQSQFMPSSYLTYGADGNGDGKID
IWANTDDVFASTANYLAKEGWKGDQGWGLEVKLPANFDGALSGLKNNQMHPASYWQQRGV
TQVDGSPLMSTATRSWIITPDDTQGRAFLVYDNFRTIMHWNRSTYFALSIGMMADGIMGS
QSPVVSGDLAPATTPAPSAPLAPAPHNPFSG