Protein Info for EX31_RS10540 in Rahnella sp. WP5

Annotation: glycosyltransferase family 2 protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF00535: Glycos_transf_2
  • amino acids 4 to 165 (162 residues), 108.2 bits, E=2.3e-35

Best Hits

Swiss-Prot: 78% identical to GTRB_BPP22: Bactoprenol glucosyl transferase (gtrB) from Salmonella phage P22

KEGG orthology group: None (inferred from 79% identity to cko:CKO_01844)

MetaCyc: 77% identical to CPS-53 (KpLE1) prophage; bactoprenol glucosyl transferase (Escherichia coli K-12 substr. MG1655)
Phosphopolyprenol glucosyltransferase. [EC: 2.4.1.78]

Predicted SEED Role

"Polymyxin resistance protein ArnC, glycosyl transferase (EC 2.4.-.-)" in subsystem Lipid A-Ara4N pathway ( Polymyxin resistance ) (EC 2.4.-.-)

KEGG Metabolic Maps

• Lipopolysaccharide biosynthesis

Isozymes

Compare fitness of predicted isozymes for: 2.4.-.-

Use Curated BLAST to search for 2.4.-.- or 2.4.1.78

Protein Sequence (305 amino acids)

>EX31_RS10540 glycosyltransferase family 2 protein (Rahnella sp. WP5)
MKISLIVPVFNEEDTIDIFYRTVREQLSQYEVEIVFVNDGSVDNTKKIITALTISDPLVT
SLCFTRNFGKEPALFAGLEASTGDAVIPIDVDLQDPIDVIPRLIEKWQDGADVVLAKRSD
RLSDSHFKRKSAEWFYRLHNMISYPKIEENVGDFRLMSRAVVENIKSLPERNLFMKGVLS
WVGGRTEIVEYTRDERVAGSTKFNGWKLWNLALEGITSFSTLPLRIWTYVGFFVAALSFV
YGAWMIIDKLIWGNPVAGYPSILVSILFLGGIQLIGIGVLGEYIGRIYIETKKRPRYILS
KSDKE