Protein Info for EX31_RS10535 in Rahnella sp. WP5

Annotation: GtrA family protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 119 transmembrane" amino acids 8 to 30 (23 residues), see Phobius details amino acids 36 to 55 (20 residues), see Phobius details amino acids 67 to 85 (19 residues), see Phobius details amino acids 92 to 116 (25 residues), see Phobius details PF04138: GtrA_DPMS_TM" amino acids 7 to 116 (110 residues), 54 bits, see alignment E=9.6e-19

Best Hits

Swiss-Prot: 55% identical to GTRA_BPSF5: Bactoprenol-linked glucose translocase (gtrA) from Shigella phage SfV

KEGG orthology group: None (inferred from 57% identity to esa:ESA_03026)

Predicted SEED Role

No annotation

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (119 amino acids)

>EX31_RS10535 GtrA family protein (Rahnella sp. WP5)
MLKIFVKYAFIGGLNTAIHWLTFAAVYFSFGHDQMVSNFSGFCVAVTFSFFANAKWTYQA
DHTATKYFLYVGFMGSISLACGYFGNKVELNPVLTLIVFSAISLIVGFLYSTFIIFREE